close

Вход

Забыли?

вход по аккаунту

?

PL175360B1

код для вставкиСкачать
(12) OPIS PATENTOWY (19)PL (11)175360
R Z E C Z P O S P O L IT A
POLSKA
(21) Numer zgłoszenia:
(22) Data zgłoszenia:
(13)B1
323367
09.05.1994
(86) Data i numer zgłoszenia międzynarodowego:
(51)IntCl6:
C07K 14/18
09.05.1994, PCT/US94/05151
8( ata i numer publikacji zgłoszenia
7)D
międzynarodowego:
U rząd P atentow y
R zeczypospolitej Polskiej
(54)
(30)
24.11.1994, WO94/27153,
PCT Gazette nr 26/94
Cząsteczka kwasu nukleinowego i kompozycja
do wykrywania infekcji wirusa zapalenia wątroby typu C
Pierwszeństwo:
10.05.1993,US,08/060400
(62)
Uprawniony z patentu:
CHIRON CORPORATION, Emeryville, US
Numer zgłoszenia,
z którego nastąpiło wydzielenie:
311653
(43)
(73)
(72)
Twórcy wynalazku:
David Y. Chien, Alamo, US
George Kuo, San Francisco, US
Zgłoszenie ogłoszono:
04.03.1996 BUP 05/96
(74)
(45)
O udzieleniu patentu ogłoszono:
Pełnomocnik:
Ostrowska Elżbieta, POLSERVICE
31.12.1998 WUP 12/98
PL 175360
B1
5( 7
)
1. Cząsteczka kwasu nukleinowego obejmującą sekwencję nukleotydową pochodzącą z
genomu wirusa zapalenia wątroby typu C kodująca sekwencję aminokwasową zawierającą
epitop typowo swoisty znajdujący się w obrębie
regionu rdzeniowego wirusa zapalenia wątroby
typu C, znamienna tym, że epitop ten zlokalizowany jest między resztami aminokwasowymi 67 i 84 wirusa zapalenia wątroby typu C-l
albo homologicznymi regionami innych typów
wirusów zapalenia wątroby typu C.
FIG. 1
C 12N 15/40
Cząsteczka kwasu nukleinowego i kompozycja
do wykrywania infekcji wirusa zapalenia wątroby typu C
Zastrzeżenia
patentowe
1. Cząsteczka kwasu nukleinowego obejmującą sekwencję nukleotydową pochodzącą z
genomu wirusa zapalenia wątroby typu C kodująca sekwencję aminokwasową zawierającą
epitop typowo swoisty znajdujący się w obrębie regionu rdzeniowego wirusa zapalenia wątroby
typu C, znamienna tym, że epitop ten zlokalizowany jest między resztami aminokwasowymi
67 i 84 wirusa zapalenia, wątroby typu C-1 albo homologicznymi regionami innych typów
wirusów zapalenia wątroby typu C.
2. Cząsteczka kwasu nukleinowego obejmującą sekwencję nukleotydową pochodzącą z
genomu wirusa zapalenia wątroby typu C kodująca sekwencję aminokwasową zawierającą
epitop typowo swoisty znajdujący się w obrębie regionu NS4 wirusa zapalenia wątroby typu C,
znamienna tym, że epitop ten zlokalizowany jest pomiędzy resztami aminokwasowymi 1689
i 1718 wirusa zapalenia wątroby typu C-1 albo homologicznymi regionami innych typów
wirusów zapalenia wątroby typu C.
3. Cząsteczka kwasu nukleinowego obejmującą sekwencję nukleotydową pochodzącą z
genomu wirusa zapalenia wątroby typu C kodująca sekwencję aminokwasową zawierającą
epitop typowo swoisty znajdujący się w obrębie regionu NS5 wirusa zapalenia wątroby typu C,
znamienna tym, że epitop ten zlokalizowany jest pomiędzy resztami aminokwasowymi 2281
i 2313 wirusa zapalenia wątroby typu C-1 albo homologicznymi regionami innych typów
wirusów zapalenia wątroby typu C.
4. Kompozycja do wykrywania infekcji wirusa zapalenia wątroby typu C, posiadająca
rekombinantową cząsteczkę polinukleotydu kodującą połączenie epitopów typowo swoistych
wirusa zapalenia wątroby typu C, znamienna tym, że zawiera połączenie epitopów wybrane z
regionu rdzeniowego, niestrukturalnego regionu 4 (NS4), niestrukturalnego regionu 5 (NS5)
wirusa zapalenia wątroby typu C.
5. Kompozycja według zastrz. 4, znamienna tym, że zawiera cząsteczkę polinukleotydu
kodującą co najmniej jeden typowo swoisty epitop wybrany z każdego z reginów rdzeniowego,
NS4 i NS5 wirusa zapalenia wątroby typu C.
6. Kompozycja według zastrz. 5, znamienna tym, że wszystkie typowo specyficzne
epitopy wirusa zapalenia wątroby typu C są specyficzne dla jednego typu wirusa zapalenia
wątroby typu C.
7. Kompozycja według zastrz. 4, znamienna tym, że cząsteczka polinukleotydu kodująca
epitop typowo swoisty regionu rdzeniowego wirusa zapalenia wątroby typu C pochodzi z
sekwencji aminokwasowej pokrywającej się z aminokwasami 67-84 wirusa zapalenia wątroby
typu C-1, albo homologicznymi regionami innych typów wirusów zapalenia wątroby typu C.
8. Kompozycja według zastrz. 4, znamienna tym, że cząsteczka polinukleotydu kodująca
epitop typowo swoisty regionu NS4 wirusa zapalenia wątroby typu C pochodzi z sekwencji
aminokwasowej pokrywającej się z aminokwasami 1689-1718 wirusa zapalenia wątroby typu
C-1, albo homologicznymi regionami innych typów wirusów zapalenia wątroby typu C.
9. Kompozycja według zastrz. 7, znamienna tym, że cząsteczka polinukleotydu kodująca
epitop typowo swoisty regionu NS4 wirusa zapalenia wątroby typu C pochodzi z sekwencji
aminokwasowej pokrywającej się z aminokwasami 1689-1718 wirusa zapalenia wątroby typu
C-1, albo homologicznymi regionami innych typów wirusów zapalenia wątroby typu C.
10.
Kompozycja według zastrz. 4, znamienna tym, że cząsteczka polinukleotydu kodująca
epitop typowo swoisty regionu NS5 wirusa zapalenia wątroby typu C pochodzi z aminokwasowej sekwencji pokrywającej się z aminokwasami 2281-2313 wirusa zapalenia wątroby typu C-1,
albo homologicznymi regionami innych typów wirusów zapalenia wątroby typu C.
175 360
3
11.
Kompozycja według zastrz. 9, znamienna tym, że cząsteczka polinukleotydu kodująca epitop typowo swoisty regionu NS5 wirusa zapalenia wątroby typu C pochodzi z aminokwasowej sekwencji pokrywającej się z aminokwasami 2281-2313 wirusa zapalenia wątroby
typu C-1, albo homologicznymi regionami innych typów wirusów zapalenia wątroby typu C.
* * *
Przedmiotem wynalazku jest cząsteczka kwasu nukleinowego i kompozycja do wykrywania infekcji wirusa zapalenia wątroby typu C (HCV). Wynalazek służy do klasyfikowania HCV.
Wiadomo, że wirusowe zapalenie wątroby powodowane jest przez pięć różnych wirusów,
znanych jako wirusy zapalenia wątroby A, B, C, D, i E. HAV jest RNA-wirusem i nie powoduje
długotrwałych objawów klinicznych. HBV jest DNA wirusem. HDV jest wirusem zależnym,
niezdolnym do zakażenia komórek w nieobecności HBV. HEV jest wirusem przenoszonym z
wodą. Początkowo, wirus HCV zidentyfikowano i scharakteryzowano jako przyczynę zapalenia
wątroby nie-A i nie-B (NANBH). Wirus ten został ujawniony przez Houghtona i wsp. w
publikacji opisu patentowego europejskiego, EP 388.232. Doprowadziło to do opracowania
wielu nieswoistych i swoistych polipeptydów użytecznych jako odczynniki immunologiczne do
identyfikacji HCV (Choo i wsp., Science, 1989 244, 359-362; Kuo i wsp., Science 1989, 244,
362-364; Houghton i wsp., Hepatology, 1991,14, 381-388. Wirus HCV jest główną przyczyną
zapalenia wątroby nabywanego po transfuzji krwi.
Prototypowy izolat HCV jest scharakteryzowany w publikacji opisów patentowych
europejskich, nr 318.216 i 388.232. Stosowany w niniejszym opisie termin "HCV" obejmuje
nowo wyizolowane rodzaje wirusów NANBH. Termin HCV-1" odnosi się do wirusa opisanego
w wyżej cytowanych publikacjach.
Od czasu pierwszej identyfikacji wirusa HCV, zidentyfikowano i oznaczono symbolami
od HCV-1 do HCV-6 co najmniej sześć różnych typów tego wirusa (Cha i wsp., Proc. Natl.
Acad. Sci. USA, 1992, 89, 7144-7148). W obrębie tych typów istnieje wiele podtypów. Typ
wirusa, którym jest zakażony pacjent jest odpowiedzialny za prognozę klinicznego przebiegu
zakażenia oraz reakcję na różne rodzaje leczenia (Yoshioka i wsp., Hepatology, 1992, 16,
293-299). W świetle faktu, że najgroźniejszym rezultatem infekcji wirusem HCV jest rak
komórek wątrobę, mogłaby być użyteczna możliwość oznaczenia typu lub typów wirusa HCV,
którymi jest zakażony pacjent.
Sposobem stosowanym obecnie do oznaczenia typu wirusa jest oznaczenie jego geneotypu, polegające na izolowaniu wirusowego RNA i oznaczaniu sekwencji różnych segmentów
techniką łańcuchowej reakcji z użyciem polimerazy (PCR). Sposób ten jest praco- i czasochłonny
i nie nadaje się do analizowania próbek przechowywanych w warunkach nie pozwalających na
konserwację RNA ani próbek pobranych od pacjentów z niedostatecznym mianem wirusa.
Użyteczny byłby więc sposób klasyfikacji HCY przez analizę immunologiczną albo oznaczanie
stereotypu.
Stosowanym obecnie sposobem skriningu krwi i diagnozowania pacjentów jest próba
immunologiczna. W próbie tej wykorzystuje się antygen z HCV-1, który zawiera wystarczającą
ilość pospolitych epitopów do tego, aby były wykrywane przeciwciała wobec innych typów
HCV. Ta próba nie daje rozróżnienia pomiędzy infekcjami różnymi typami wirusa HCV.
Przedmiotem wynalazku jest cząsteczka kwasu nukleinowego obejmującą sekwencję
nukleotydową pochodzącą z genomu wirusa zapalenia wątroby typu C kodująca sekwencję
aminokwasową zawierającą epitop typowo swoisty znajdujący się w obrębie regionu rdzeniowego wirusa zapalenia wątroby typu C, charakteryzująca się tym, że epitop ten zlokalizowany
jest między resztami aminokwasowymi 67 i 84 wirusa zapalenia wątroby typu C-1 albo
homologicznymi regionami innych typów wirusów zapalenia wątroby typu C.
W odmianie wynalazku przedmiotem wynalazku jest także cząsteczka kwasu nukleinowego obejmującą sekwencję nukleotydową pochodzącą z genomu wirusa zapalenia wątroby typu
C kodująca sekwencję aminokwasową zawierającą epitop typowo swoisty znajdujący się w
obrębie regionu NS4 wirusa zapalenia wątroby typu C, charakteryzująca się tym, że epitop ten
4
175 360
zlokalizowany jest pomiędzy resztami aminokwasowymi 1689 i 1718 wirusa zapalenia wątroby
typu C-1 albo homologicznymi regionami innych typów wirusów zapalenia wątroby typu C.
W kolejnym wariancie przedmiotem wynalazku jest cząsteczka kwasu nukleinowego
obejmującą sekwencję nukleotydową pochodzącą z genomu wirusa zapalenia wątroby typu C
kodująca sekwencję aminokwasową zawierającą epitop typowo swoisty znajdujący się w obrębie
regionu NS5 wirusa zapalenia wątroby typu C, charakteryzująca się tym, że epitop ten zlokalizowany jest pomiędzy resztami aminokwasowymi 2281 i 2313 wirusa zapalenia wątroby typu
C-1 albo homologicznymi regionami innych typów wirusów zapalenia wątroby typu C.
Przedmiotem wynalazku jest także kompozycja do wykrywania infekcji wirusa zapalenia
wątroby typu C, posiadająca rekombinantową cząsteczkę polinukleotydu kodującą połączenie
epitopów typowo swoistych wirusa zapalenia wątroby typu C, charakteryzująca się tym, że
zawiera połączenie epitopów wybrane z regionu: rdzeniowego, niestrukturalnego regionu 4
(NS4), niestrukturalnego regionu 5 (NS5) wirusa zapalenia wątroby typu C.
W korzystnym wykonaniu kompozycja według wynalazku może zawierać cząsteczkę
polinukleotydu kodującą co najmniej jeden typowo swoisty epitop wybrany z każdego z reginów
rdzeniowego, NS4 i NS5 wirusa zapalenia wątroby typu C. Również korzystnie w kompozycji
według wynalazku wszystkie typowo specyficzne epitopy wirusa zapalenia wątroby typu C są
specyficzne dla jednego typu wirusa zapalenia wątroby typu C. Korzystnie kompozycja według
wynalazku charakteryzuje się tym, że cząsteczka polinukleotydu kodująca epitop typowo
swoisty regionu rdzeniowego wirusa zapalenia wątroby typu C pochodzi z sekwencji aminokwasowej pokrywającej się z aminokwasami 67-84 wirusa zapalenia wątroby typu C-1, albo z
homologicznymi regionami innych typów wirusów zapalenia wątroby typu C. W innym korzystnym wykonaniu kompozycji według wynalazku cząsteczka polinukleotydu kodująca epitop
typowo swoisty regionu NS4 wirusa zapalenia wątroby typu C pochodzi z sekwencji aminokwasowej pokrywającej się z aminokwasami 1689-1718 wirusa zapalenia wątroby typu C-1, albo z
homologicznymi regionami innych typów wirusów zapalenia wątroby typu C. W kolejnym
korzystnym wykonaniu kompozycja według wynalazku charakteryzuje się tym, że cząsteczka
polinukleotydu kodująca epitop typowo swoisty regionu NS4 wirusa zapalenia wątroby typu C
pochodzi z sekwencji aminokwasowej pokrywającej się z aminokwasami 1689-1718 wirusa
zapalenia wątroby typu C-1, albo z homologicznymi regionami innych typów wirusów zapalenia
wątroby typu C. Korzystnie kompozycja według wynalazku charakteryzuje się tym, że cząsteczka polinukleotydu kodująca epitop typowo swoisty regionu NS5 wirusa zapalenia wątroby
typu C pochodzi z aminokwasowej sekwencji pokrywającej się z aminokwasami 2281-2313
wirusa zapalenia wątroby typu C-1, albo homologicznymi regionami innych typów wirusów
zapalenia wątroby typu C. Również korzystnie w kompozycji według wynalazku cząsteczka
polinukleotydu kodująca epitop typowo swoisty regionu NS5 wirusa zapalenia wątroby typu C
pochodzi z aminokwasowej sekwencji pokrywającej się z aminokwasami 2281-2313 wirusa
zapalenia wątroby typu C-1, albo homologicznymi regionami innych typów wirusów zapalenia
wątroby typu C.
Cząsteczka kwasu nukleinowego według wynalazku koduje sekwencję aminokwasową
polipeptydów zawierających epitopy typowo-swoiste albo epitopy swoiste wobec wiązki typów.
Polipeptydy te wywodzą się z trzech różnych regionów genomu HCV. Jeden zestaw polipeptydów obejmuje epitopy typowo-swoiste albo epitopy swoiste wobec wiązki typów, otrzymane z
regionu rdzeniowego wirusa HCV. Ten pierwszy zestaw znajduje się pomiędzy resztami
aminokwasowymi 67 a 84 wirusa HCV-1 i homologicznymi regionami innych typów HCV. W
niniejszym opisie użyte są następujące skróty reszt aminokwasowych: A = alanina, I - izoleucyna,
L - leucyna, M - metionina, F - fenyloalanina, P - prolina, W- trypofan, V - walina, N - asparagina,
C - cysteina, Q- glutamina, G - glicyna, S - seryna, T - treotonina, Y- tyrozyna, R - arginina, H
- histydyna, K - lizyna, D- kwas asparaginowy i E = kwas glutaminowy.
Poszczególne sekwencje reszt aminokwasoych wywodzące się z regionu rdzeniowego i
podtypy, z których je otrzymano są następujące:
1. PEGRTWAQ podtyp 1a albo 1b
2. STGKSWGK, podtyp 2a albo 2b
3. SEGRSWAQ, podtyp 3a albo 4.
175 360
5
Inny zestaw polipeptydów obejmuje typowo-swoisty epitop otrzymany z niestrukturalnego regionu 4 wirusa HCV (NS4). Ten drugi zestaw obejmuje obszar pomiędzy resztami
aminokwasowymi 1689a 1718 wirusa HCV-1 i homologicznymi regionami innych typów HCV.
Poszczególne sekwencje reszt aminokwasowych oraz typy i podtypy, z których one
pochodzą są następujące:
1. CSQHLPY, podtyp 1a
2. CASHLPY, podtyp 1b
3. CASRAAL, podtyp 2a albo 2b
Jeszcze inny zestaw polipeptydów obejmuje epitop typowo-swoisty albo epitopy swoiste
względem wiązki typów, otrzymane z niestrukturalnego regionu 5 (NS5) wirusa zapalenia
wątroby typu C. Ten zestaw znajduje się pomiędzy resztami aminokwasowymi 2281 a 2313
wirusa HCV-1 i homologicznymi regionami innych typów wirusa zapalenia wątroby typu C.
Poszczególne sekwencje reszt aminokwasowych oraz typy i podtypy, z których one
pochodzą są następujące:
1. PDYEPPVVHG, podtyp 1a
2. PDYVPPVVHG, podtyp 1b
3. PDYQOATVAG, podtyp 2a
4. PGYEPPTVLG, podtyp 2b
5. FAQASPVW, podtyp 1a
6. FPPQALPIW, podtyp 1b
7. FPQALPAW, podtyp 2a
8. FPPQALPPW podtyp 2b.
Cząsteczka kwasu nukleinowego według wynalazku jest użyteczna jako sonda, np. w
próbach plamienia Southera lub w innych próbach rozpoznania DNA, takich jak próba wychwytywania, opisana w opisach patentowych Stanów Zjednoczonych Ameryki nr 4.868.105
i 5.124.246.
W jeszcze innym aspekcie, przedmiotem wynalazku są cząsteczki kwasu nukleinowego
komplementarne do sekwencji kwasu nukleinowego flankujących regiony kodujące epitopy
typowo swoiste i epitopy swoiste wobec wiązki typów. Te cząsteczki kwasu nukleinowego są
użyteczne do prowadzenia łańcuchowej reakcji z udziałem polimerazy (PCR) do oznaczania
geneotypów konkretnych HCV.
Wynalazek został zilustrowany na rysunku, na którym fig. 1 przedstawia schemat strategii
doświadczalnego oznaczenia sereotypu. Fig. 2 przedstawia schemat strategii wyczerpującego
mapowania epitopu. Fig. 3 przedstawia kompilację wykresów przedstawiających wyniki mapowania epitopu wirusa HCV 1a (Rodney). Fig. 4 przedstawia kompilację wykresów przedstawiających wyniki mapowania epitopu wirusa HCV 2b (Nomoto).
Definicje
"Wirus zapalenia wątroby typu C" albo "HCV" odnosi się do tych rodzajów wirusa, których
typy patogenne powodują NANBH oraz do pochodzących od nich typów atenuowanych albo
defektywnych cząstek interferujących. Wirus ten jest opisany w publikacjach cytowanych w
niniejszym opisie. Genom HCV jest zbudowany z RNA. Wirusy zawierające RNA charakteryzują się stosunkowo wyższymi szybkościami mutacji spontanicznych, szacowanych na rząd
10-3 do 10-4 na wbudowany nukleotyd (Fields i Knipe, Fundamental Virology", 1986, Raven
Press, NY). Ponieważ heterogenność i płynność geneotypu są u RNA-wirusów cechami dziedzicznymi, w obrębie rodzaju HCV istnieje wiele typów i podtypów, które mogą być wirulentne
albo niezłośliwe. Namnażnie, identyfikacja, detekcja i izolacja różnych typów i izolatów HCV
są udokumentowane w piśmiennictwie. Jak zaznaczono, wszystkie sekwencje nukleotydowe
i aminokwasowe pochodzą z wymienionych typów HCV. Ilość sekwencji genomowych HCV-1
i aminokwasowych jest taka, jaka jest opisana przez Choo i wsp., Brit. Med. Buli. 1990,4 6 , 423
- 441. Ujawnienie zawarte w opisie pozwala na oznaczenie różnych typów.
Użyty w opisie termin "typ" oznacza wirusy HCV różniące się pod względem genotypu o
więcej niż około 30%, określenie "podtyp" oznacza wirusy HCV różniące się pod względem
genotypu o 10 - 20%; a określenie "izolat" oznacza wirusy różniące się genotypowo o mniej niż
6
175 360
około 10%. "Klasyfikowanie" odnosi się do rozróżnienia jednego typu wirusa HCV od drugiego
typu.
W publikacji zgłoszenia międzynarodowego, WO 93/00365 znajduje się informacja o
kilku typach/podtypach HCV, zwłaszcza o typie lub podtypie CDC/HCV1 (zwanym również
HCV-1). Informacja o jednym typie albo podtypie, taka jak częściowa sekwencja genomowa
lub aminokwasową, jest wystarczająca dla specjalisty z tej dziedziny stosującego standardowe
techniki do wyizolowania nowych typów HCV. Przykładowo, przeprowadzono skrining kilku
różnych typów HCV w sposób opisany poniżej. Takie typy, które uzyskano z wielu surowic
ludzkich (i z różnych stref geograficznych) klasyfikowano stosując sposób i odczynniki opisane
w niniejszym opisie.
Wprowadzono strukturę genomu i sekwencję nukleotydową genomowego RNA wirusa
HCV-1. Okazuje się, że genom jest jednoniciowym RNA zawierającym 10.000 nukleotydów.
Genom posiada nić dodatnią i ciągłą, translacyjną otwartą ramkę odczytu (ORF) kodującą
poliproteinę złożoną z około 3000 aminokwasów. W tej ramce ORF, białko strukturalne jest
kodowane w mniej więcej pierwszej ćwiartce regionu końca aminowego a z większej części tej
poliproteiny powstają białka niestrukturalne (NS). Przy porównaniu ze wszystkimi znanymi
sekwencjami wirusowymi, obserwuje się niewielkie ale znaczące ko-liniwe homologię z białkami niestrukturalnymi (NS) z rodziny flawiwirusa i z pestywirusami (co do których, obecnie
uważa się, że stanowią część rodziny Flaviwirusów).
Opierając się na przypuszczalnych resztach aminokwasowych kodowanych przez sekwencję nukleotydową HCV-1 i na innym dowodzie, wyprowadzono możliwe domeny białkowe
kodowanej poliproteiny HCV oraz przybliżone wiązania. Są one przedstawione w tabe l i 1.
T a b e la 1
Przypuszczalna domena
Przybliżone wiązania
(numery aminokwasów)
C (białko nukleokapsydu)
1 - 191
E1 (białko otoczki wirionu)
192 - 383
E2 /NSI
384 - 800
(otoczka)
NS2
(funkcja nieznana)
NS3
(proteaza)
1050 - 1650
NS4
(funkcja nieznana)
1651 - 2100
NS5
(polimeraza)
800 - 1050
2100 - 3011
(koniec)
Te domeny są przypuszczalne. Przykładowo, granica El- NS2 znajduje się prawdopodobnie w regionie 750 - 810 a granica NS3-NS4 istnieje przypuszczalnie w regionie około 1640
- 1650. Istnieje również dowód na to, że wersja C zawierająca 191 aminokwasów (aa) jest
prekursorem podlegającym dalszemu przetwarzaniu do długości około 170 aminokwasów i do
N52. Obydwa białka są dalej przetwarzane do dwu białek dojrzałych.
Różne typy HCV definiuje się według różnych kryteriów, takich jak np. ORF o długości
od około 9.000 nukleotydów do około 12.000 nukleotydów, kodująca białko o rozmiarach
podobnych do rozmiarów HCV-1, kodowana poliproteina o właściwościach hydrofobowych
i/lub antygenowych podobnych do tych, jakie posiada HCV-1 oraz obecność ko-liniowych
sekwencji polipeptydowych zachowanych w wirusie HCY-1.
175 360
7
Do identyfikacji typów HCV można zastosować następujące parametry homologii kwasu
nukleinowego i homologii aminokwasowej, bądź pojedynczo bądź w kombinacji. Na ogół, jak
podano powyżej, różne typy HCV wykazują około 70% homologii, podtypy wykazują 80 - 90%
homologii a izolaty charakteryzują się homologią około 90 procentową.
Używane w opisie określenie: polinukleotyd "pochodzący z" określonej sekwencji odnosi
się do sekwencji polinukleotydowej złożonej z co najmniej około 6 nukleotydów, korzystnie, co
najmniej około 8 nukleotydów, korzystniej, co najmniej około 10 do 12 nukleotydów a nawet
bardziej korzystnie, co najmniej około 15 do 20 nukleotydów korespondujących z regionem tej
określonej sekwencji nukleotydowej. Wyrażenie "korespondujący" oznacza homologiczny z
określoną sekwencją albo do niej komplementarny. Korzystnie, sekwencja regionu, z którego
pochodzi polinukleotyd jest homologiczna z sekwencją unikalną w genomie HCV albo jest do
tej sekwencji komplementarna.
Techniki hybrydyzacji do oznaczania komplementarności sekwencji kwasów nukleinowych są znane. Są one np. opisane przez Maniatisa i wsp. (1982). Ponadto, niedopasowania
polinukleotydów dupleksowych powstających w wyniku hybrydyzacji można oznaczyć znanymi technikami, w tym np. techniką trawienia nukleazą, taką jak nukleaza S 1, która swoiście trawi
jednoniciowe obszary polinukleotydów dupleksowych. Regiony, z których mogą pochodzić
typowe sekwencje DNA obejmują ale nie ograniczają się do np. regionów kodujących epitopy
typowo swoiste oraz regiony nie podlegające transkrypcji ani/lub translacji.
Pochodny polinukleotyd niekoniecznie fizycznie pochodzi z przedstawionej sekwencji
nukleotydowej ale może być otrzymany w dowolny sposób, w tym np. przez syntezę chemiczną,
przez replikację DNA albo przez odwrotną transkrypcję lub translację. Poza tym, można
modyfikować kombinacje regionów odpowiadających wyznaczonej sekwencji znanymi metodami, tak, aby były one odpowiednie do zamierzonego zastosowania.
Podobnie, określenie: polipeptyd albo sekwencja aminokwasową "pochodząca z" określonej sekwencji aminokwasowej albo sekwencji kwasu nukleinowego odnosi się do polipeptydu
posiadającego sekwencję aminokwasową identyczną z tą, jaką posiada polipeptyd kodowany w
tej sekwencji albo jego części, która to część składa się z co najmniej 3 do 5 aminokwasów,
korzystniej co najmniej 8 - 1 0 aminokwasów, a jeszcze korzystniej co najmniej 11 do 15
aminokwasów albo odnosi się do polipeptydu, który jest możliwy do identyfikacji immunologicznej za pomocą polipeptydu kodowanego w tej sekwencji. Termin ten obejmuje również
polipeptyd wytwarzany przez ekspresję określonej sekwencji kwasu nukleinowego.
Rekombinantowy lub pochodny polipeptyd nie musi powstawać w wyniku translacji
określonej sekwencji kwasu nukleinowego. Można go wytwarzać w dowolny sposób, obejmujący np. syntezę chemiczną albo ekspresję rekombinantowego układu ekspresyjnego albo
izolację z HCV, w tym z imitowanego HCV. Polipeptydy przedstawione w niniejszym opisie są
relatywnie krótkie, a zatem, najłatwiej się je syntetyzuje drogą chemiczną.
Taki rekombinantowy lub pochodny polipeptyd może zawierać w swej sekwencji jeden
lub większą ilość analogów aminokwasów albo aminokwasów nie występujących w stanie
naturalnym. Metody wbudowywania analogów aminokwasów do sekwencji są znane. Można
również włączać jeden lub większą ilość znaczników, co jest sprawą znaną dla specjalisty z tej
dziedziny. Szczegółowy opis analogów i "mimotopów" znajduje się w opisie patentu Stanów
Zjednoczonych Ameryki nr 5.194.392.
Do analogów peptydowych należą analogi, w których dokonano delecji, addycji, podstawienia albo modyfikacji przy zachowaniu zdolności rozpoznawania typu wirusa HCV. Do
korzystnych "podstawień" należą podstawienia konserwatywne, to znaczy takie, w których dana
reszta jest zastąpiona przez inną resztę tego samego typu. Jak wiadomo, aminokwasy występujące w stanie naturalnym można dzielić na kwaśne, zasadowe, obojętne i polarne albo obojętne
i niepolarne. Ponadto, trzy kodowane aminokwasy są aromatyczne. Korzystne jest, aby kodowane polipeptydy różniące się od naturalnego epitopu zawierały podstawione kodony dla
aminokwasów należących do tej samej grupy co zastępowany aminokwas. Tak więc, aminokwasy zasadowe: Lys, Arg i His są w zasadzie wzajemnie wymienialne, aminokwasy kwaśne: kwas
asparaginowy i kwas glutaminowy są wzajemnie wymienialne, obojętne, polarne aminokwasy:
Ser, Thr, Cys, Gin i Asn są wzajemnie wymienialne, niepolarne alifatyczne aminokwasy: Gly,
8
175 360
Ala, Val, He i Leu są w stosunku do siebie nawzajem konserwatywne (ale z powodu rozmiarów,
ściślej spokrewnione są Gly z Ala oraz Val z Ile i z Leu) a także aromatyczne aminokwasy: Phe,
Trp i Tyr są wzajemnie wymienialne. Prolina jest aminokwasem niepolarnym i obojętnym, a
pomimo tego stwarza trudności z powodu swego wpływu na konformację. Podstawienia proliną
lub w miejsce proliny nie są korzystne za wyjątkiem przypadków, kiedy można uzyskać tę samą
albo zbliżoną konformację. Do polarnych aminokwasów reprezentujących zmiany konserwatywne należą Ser, Thr, Gln, Asn i w mniejszym stopniu Met. Ponadto, Ala, Gly i Ser, jakkolwiek
klasyfikuje się je w różnych kategoriach, wydają się być wzajemnie wymienialne a Cys
dodatkowo pasuje do tej grupy albo może być klasyfikowana do polarnych obojętnych aminokwasów.
Należy poza tym zaznaczyć, że jeśli polipeptydy wytwarza się syntetycznie, można
również dokonywać podstawień przez aminokwasy, które nie są kodowane przez dany gen. Do
takich alternatywnych reszt należą na przykład omega-aminokwasy o wzorze H2 N(CH 2 )nCOOH,
w którym n ma wartość 2 do 6. Są to obojętne, niepolarne aminokwasy takie jak sarkozyna (Sar),
t-butylo-alanina (t-BuA), t-butylo-glicyna (t-BuG), N-metylo-izoleucyna (N-Melle) i norleucyna (Nie). Przykładowo, fenyloglicynę można podstawić w miejsce Trp, Tyr albo Phe, aromatycznego aminokwasu obojętnego. Cytrulina (Cit) i sulfotlenek metioniny (MSO) są polarne ale
obojętne, cykloheksyloalanina (Cha) jest obojętna i niepolarna, kwas cysteinowy (Cya) jest
kwaśny a omityna (Orn) jest zasadowa. Właściwości konformacyjne nadane obecnością reszt
proliny można zachować podstawiając jedną lub większą ilość tych reszt hydroksyproliną (Hyp).
Termin "polinukleotyd rekombinantowy" oznacza w niniejszym opisie polinukleotyd
pochodzenia genomowego, cDNA, półsyntetyczny, który ze względu na swe pochodzenie albo
w wyniku manipulacji (1) nie jest związany ani z całością ani z częścią polinukleotydu, z którym
jest związany w stanie naturalnym, (2) jest połączony z polinukleotydem innym niż ten, z którym
jest związany w stanie naturalnym albo (3) nie występuje w stanie naturalnym.
Termin "polinukleotyd" oznacza w niniejszym opisie polimeryczną formę nukleotydów o
dowolnej długości, zarówno rybonukleotydów jak i dezoksyrybonukleotydów. Termin ten
odnosi się tylko do struktury pierwszorzędowe] cząsteczki. Tak więc, obejmuje on dwu- i
jednoniciowy DNA i RNA. Zawiera on również znane typy modyfikacji, np. znaczniki znane w
stanie techniki, formy metylowane, formy o strukturze "cap" (osłonięte), formy zawierające
podstawienie jednego lub większej ilości naturalnie występujących nukleotydów analogiem,
polinukleotydy zawierające modyfikacje międzynukleotydowe, takie jak np. wiązania nie zawierające ładunków (np. metylofosfonianowe, fosfotrójestrowe, amidofosforanowe, karbaminianowe i podobne) oraz takie, które zawierają ładunki (np. tiofosforany, ditiofosforany i
podobne), takie, które zawierają reszty wiszące, np. białka takie jak nukleazy, toksyny, przeciwciała, peptydy sygnalne i poli-L-lizyna, polinukleotydy zawierające interkalatory (takie jak
akrydyna, psoralen i podobne), zawierające chelatory (np. metale, metale radioaktywne, bor,
metale utleniające i podobne), takie, które zawierają środki alkilujące, takie, które zawierają
wiązania modyfikowane (np. alfa anomeryczne kwasy nukleinowe i podobne) oraz niemodyfikowane formy tego polinukleotydu. Polinukleotydy przedstawione w opisie są relatywnie
krótkie, a zatem łatwo je otrzymać na drodze syntezy chemicznej.
Określenie "oczyszczony polipeptyd" odnosi się do polipeptydu w stanie zasadniczo
wolnym od innych polipeptydów, to znaczy, w kompozycji zawierającej co najmniej około 50%
wagowych (stosunek żądanego polipeptydu do całkowitej ilości wszystkich polipeptydów w
kompozycji), korzystnie co najmniej około 70% a nawet bardziej korzystnie, co najmniej około
90% żądanego polipeptydu, bez uwzględniania materiału niebiałkowego w tej kompozycji.
Techniki oczyszczania wirusowych polipeptydów są znane. Oczyszczone przeciwciała są zdefiniowane podobnie w stanie techniki.
Wyrażenie "epitop" oznacza determinantę antygenową polipeptydu. Epitop może zawierać 3 albo większą ilość aminokwasów decydujących o miejscu wiązania z przeciwciałem.
W zasadzie, epitop składa się z co najmniej 5 aminokwasów a czasem zawiera co najmniej 8
aminokwasów. Metody mapowania epitopów są znane.
175 360
9
Termin "epitop typowo-swoisty" odnosi się do epitopu występującego w jednym typie
HCV. Wyrażenie "epitop swoisty dla wiązki typów" znajduje się w więcej niż jednym ale nie
we wszystkich typach HCV. Przykładowo, konkretny epitop może być rozpoznawany przez
przeciwciała pochodzące od pacjenta zakażonego wirusem HCV-1 ale nie będą rozpoznawane
albo będą rozpoznawane mniej skutecznie przez przeciwciała pochodzące od pacjenta zakażonego wirusem HCV-2. Podobnie, epitop swoisty dla wiązki typów pochodzący z HCY-3 może
być rozpoznany przez przeciwciała pochodzące od pacjenta zakażonego wirusem HCV-3 albo
HCV-4 ale nie przez przeciwciała pochodzące od pacjenta zakażonego wirusami HCY-1 albo
HCV-2. "Konserwatywnymi epitopami "są te, które są rozpoznawane przez przeciwciała swoiste
dla wszystkich typów HCV.
Polipeptyd jest "reaktywny immunologicznie" z przeciwciałem, które przyłącza się do
peptydu w wyniku rozpoznania przez to przeciwciało swoistego epitopu zawartego w tym
polipeptydzie. Reaktywność immunologiczną można oznaczać przez wiązanie z przeciwciałem,
zwłaszcza przez oznaczanie kinetyki wiązania z przeciwciałem i/lub przez oznaczanie kompetycji wiązania, stosując jako czynniki konkurencyjne znane polipeptydy zawierające epitop
przeciwko któremu jest skierowane to przeciwciało. Techniki określania, czy polipeptyd jest
reaktywny immunologicznie z danym przeciwciałem są znane.
Stosowany w niniejszym opisie termin "przeciwciało" odnosi się do polipeptydu albo
grupy polipeptydów zawierających co najmniej jedno miejsce wiążące. "Miejsce wiążące
przeciwciała" albo "domena wiążąca" powstają w wyniku sfałdowania domen zmiennych
cząsteczki przeciwciała z utworzeniem trójwymiarowych przestrzeni wiążących, w których
kształt powierzchni wewnętrznej i rozmieszczenie ładunków jest komplementarne do charakterystycznych cech epitopu na antygenie, co pozwala na reakcję immunologiczną z tym
antygenem. Miejsce wiążące przeciwciała może się tworzyć z domeny o łańcuchu ciężkim i/lub
lekkim (odpowiednio VHi VL) tworzącej hiperzmienne pętle biorące udział w wiązaniu antygenu. Określenie "przeciwciało" oznacza np. przeciwciała zwierząt kręgowych, przeciwciała
hybrydowe, przeciwciała chimerowe, przeciwciała zmienione, przeciwciała jednowartościowe,
białka Fab i przeciwciała jedno-domenowe.
Przeciwciała swoiste wobec polipeptydów i polipeptydy można wytwarzać dowolnym
sposobem znanym w stanie techniki. Przykładowo, polipeptydy na ogół zawiesza się w buforze
akceptowalnym fizjologicznie, miesza się je z odpowiednim adiuwantem i wstrzykuje zwierzęciu. Sposoby otrzymywania przeciwciał poliklonalnych i monoklonalnych są znane i nie są
podane w niniejszym opisie.
Określenie "polipeptyd" oznacza polimer aminokwasowe i nie określa długości własnej
produktu. Tak więc, definicją polipeptydu są objęte polipeptydy, oligopeptydy i białka. Termin
ten nie obejmuje modyfikacji postekspresyjnych tego polipeptydu, np. glikozylacji, acetylacji,
fosforylacji i podobnych. Definicją tą objęte są np. polipeptydy zawierające jeden lub większą
ilość analogów aminokwasów (w tym np. aminokwasy nie występujące w stanie naturalnym i
podobne), polipeptydy z podstawionymi wiązaniami oraz inne znane modyfikacje, zarówno
występujące w stanie naturalnym jak i nie występujące w naturze.
Pod określeniem "leczenie" rozumie się profilaktykę i/lub terapię.
Stosowane w opisie określenie "osobnik" odnosi się do kręgowców, zwłaszcza należących
do rodzaju ssaków i obejmuje ale nie ogranicza się do zwierząt (np. psów, kotów, bydła, świni,
owiec, kóz, królików, myszy, szczurów, świnek morskich i podobnych) oraz do naczelnych, w
tym małp, szympansów, pawianów i ludzi.
Wyrażenie "nić sensowna" kwasu nukleinowego oznacza sekwencję wykazującą homologię do sekwencji mRNA. "Nić antysensowna" oznacza sekwencję komplementarną do nici
sensownej.
"Genom z nicią dodatnią" danego wirusa oznacza taki wirus, w którym genom, zarówno
RNA jak i DNA, jest jednoniciowy i koduje wirusowy polipeptyd albo polipeptydy. Przykładami
RNA wirusów z nicią dodatnią są Togaviridae, Coronaviridae, Retroviridae, Picomaviridae i
Caliciviridae. Do takich wirusów należą również Flaviviridae, poprzednio klasyfikowane jako
Togaviradae (Fields i Knipe, 1986).
10
175 360
Termin "zawierająca przeciwciało próbka ciała" odnosi się do składnika ciała danego
osobnika służącego jako źródło żądanych przeciwciał. Zawierające przeciwciała składniki
organizmu są znane i obejmują ale nie ograniczają się do np. osocza, surowicy, płynu rdzeniowego, płynu limfatycznego, zewnętrznych sekcji przewodów: oddechowego, pokarmowego
i moczowo-płciowego, łez, śliny, mleka, białych krwinek i szpiczaków.
"Próbka biologiczna" oznacza próbkę tkanki lub płynu wyizolowanego z osobnika,
obejmującą ale nie ograniczającą się do np. osocza, surowicy, płynu rdzeniowego, płynu
limfatycznego, zewnętrznych sekcji skóry i przewodów: oddechowego, pokarmowego i moczowo-płciowego, łez, śliny, mleka, komórek krwi, nowotworów i narządów. Termin ten obejmuje
również próbki składników hodowli komórkowych in vitro (obejmujących ale nie ograniczających się do kondycjonowanego medium wytworzonego w wyniku wzrostu komórek w podłożu
hodowlanym, komórek przypuszczalnie zakażonych wirusem, komórek rekombinantowych i
składników komórkowych).
W praktycznym wykonaniu wynalazku, o ile nie podano inaczej, są zastosowane konwencjonalne techniki biologii molekularnej, mikrobiologii, rekombinacji DNA, syntezy polipeptydów i kwasów nukleinowych i immunologii znane w stanie wiedzy. Techniki te są w pełni
wyjaśnione w piśmiennictwie, np: Maniatis, Fitsch i Sambrook: "Molecular Cloning: A Laboratory Manual: (1982); "DNA Cloning, tomy I i II" (wyd. D.N. Glover, 1985); "Oligonucleo tide
Synthesis" (wyd. M.J. Gait, 1984); Nucleic Acid Hybridization" (wyd. B.D. Hames i S. J. Higgins,
1984); "Transcription and Translation" (wyd. B.D. Hames i S.J. Higgins, 1984); "Animal Cell
Culture" (wyd. R.I. Freshney, 1986), "Immobilized Cells And Enzymes (IRL Press, 1986); B.
Perbal, "A Practical Guide To Molecular Cloning", (1984); seria: "Methods in Enzymology"
(Academic Press, Inc.); "Gene Transfer Vectors For Mammalian Cells" (wyd. J. H. Miller i M. P.
Calos, 1987, Cold Spring Harbor Laboratory), Meth. Enzymol., tom 154 i tom 155 (wyd.
odpowiednio Wu i Grossman i Wu), wyd.: Mayer i Waler, 1987), "Immunochemical Methods
In Cell And Molecular Biology" (Academic Press, Londyn); Scopes, (1987) "Protein Purification: Principles and Practice", II wyd. (Springer Verlag, N.Y.) i "Handbook of Experimental
Immunology", tomy I - IV (wyd.. D.M. Weir i C. C. Blackwell, 1986).
Wszystkie patenty, zgłoszenia i publikacje patentowe cytowane powyżej i poniżej są
włączone do opisu jako odnośniki.
Stosując cząsteczkę kwasu nukleinowego według wynalazku przeprowadza się skutecznie
sposoby wykrywania HCV i indentyfikowania różnych typów HCV zakażających organizm.
Metody wykrywania i klasyfikowania infekcji wirusem HCV obejmują zarówno próby
immunologiczne jak i identyfikację kwasu nukleinowego metodami obejmującymi ale nie
ograniczającymi się do hybrydyzacji metodą Southerna i łańcuchowej reakcji z udziałem
polimerazy (PCR). W celu identyfikacji zakażenia HCV, próbkę biologiczną inkubuje się z
jednym z polipeptydów opisanych w niniejszym opisie w warunkach umożliwiających wiązanie
antygenu z przeciwciałem i wykonuje się oznaczenie, czy przeciwciała w próbce wiążą się z
epitopem obecnym na polipeptydzie.
Próby immunologiczne i zestawy diagnostyczne
Peptydy kodowane przez cząsteczkę kwasu nukleinowego według wynalazku zawierają
epitopy typowo swoiste i epitopy swoiste dla wiązki typów są użyteczne w próbach immunologicznych do wykrywania obecności przeciwciał HCV albo obecności wirusa i/lub antygenów
wirusowych w próbkach biologicznych. Projektowanie prób immunologicznych jest przedmiotem ogromnej zmienności i znanych jest wiele formatów. W próbie immunologicznej będzie się
stosować co najmniej jeden epitop typowo swoisty albo epitop swoisty dla wiązki typów.
W jednym rozwiązaniu, w próbie immunologicznej stosuje się kombinację epitopów typowo
swoistych i/lub epitopów swoistych dla wiązki typów.
Polipeptydy takie są przydatne do oznaczania typu HCV przez zastosowanie epitopów do
oznaczenia obecności przeciwciał swoistych względem danego typu albo przeciwciał swoistych
dla wiązki typów. Polipeptydy te są również przydatne do generowania przeciwciał swoistych
względem danego typu albo przeciwciał swoistych dla wiązki typów, które to przeciwciała mogą
być następnie stosowane w próbie immunologicznej do odróżniania różnych typów HCV.
175 360
11
Polipeptydy te pochodzą z trzech różnych regionów genomu HCV. Jeden zestaw polipeptydów zawiera epitop typowo swoisty albo epitop swoisty dla wiązki typów otrzymany z
rdzeniowego regionu HCV. Następny zestaw polipeptydów zawiera epitop typowo swoisty albo
epitop swoisty dla wiązki typów, otrzymany z niestrukturalnego regionu 4 (NS4) wirusa HCV.
Trzeci zestaw polipeptydów zawiera epitop typowo swoisty albo epitop swoisty dla wiązki
typów, otrzymany z niestrukturalnego regionu 5 (NS5) wirusa zapalenia wątroby C. Ten zestaw
znajduje się pomiędzy resztami aminokwasowymi 2281 a 2313 wirusa HCV-1 i w homologicznych regionach innych typów wirusa zapalenia wątroby typu C.
Polipeptydy te nadają się do stosowania w próbach immunologicznych na określenie
jednego albo większej ilości typów HCV. W celu oznaczenia jednego typu, próbkę kontaktuje
się z jednym lub z większą ilością polipeptydów zawierających epitop swoisty dla wiązki typów
w warunkach umożliwiających wiązanie antygenu z przeciwciałem i oznacza się, czy przeciwciała w próbce wiążą się z epitopem.
W próbie immunologicznej zaprojektowanej na oznaczanie konkretnego typu wirusa
HCV, pobiera się od osobnika próbkę biologiczną, kontaktuje się ją z pierwszym typowo
swoistym epitopem albo z epitopem swoistym dla wiązki typów w warunkach umożliwiających
wiązanie przeciwciała z antygenem, kontaktuje się ją z drugim typowo swoistym epitopem albo
z epitopem swoistym dla wiązki typów w warunkach umożliwiających wiązanie przeciwciała z
antygenem i oznacza się, czy przeciwciała w próbce wiążą się z pierwszym lub z drugim
epitopem. Procedury te można powtarzać z dowolną ilością polipeptydów zawierających epitopy
typowo swoiste i/lub epitopy swoiste dla wiązki typów.
Na ogół, próba immunologiczna na obecność przeciwciał anty-HCV polega na selekcji i
przygotowaniu badanej próbki podejrzanej o obecność przeciwciał, takiej jak próbka biologiczna, inkubacji tej próbki z epitopem typowo swoistym lub z epitopem swoistym dla wiązki typów
w warunkach pozwalających na powstawanie kompleksów antygen-przeciwciało i wykryciu
powstania takich kompleksów. Odpowiednie warunki inkubacji są znane z piśmiennictwa. Próbę
immunologiczną można bez ograniczeń prowadzić w formacie heterogennym albo homogennym, może to być typ standardowy lub kompetytywny.
W formacie heterogennym wiąże się epitop typowo swoisty albo epitop swoisty dla wiązki
typów ze stałym podłożem w celu ułatwienia oddzielenia próbki od polipeptydu po inkubacji.
Przykłady stałych podłoży, które można użyć obejmują ale nie ograniczają się do nitrocelulozy
(np. w formie błony albo ścianki wgłębienia w płytce do mikromianowania), polichlorku winylu
(np. w formie arkuszy albo ścianki wgłębienia w płytce do mikromianowania), lateksu polistyrenowego (np. w formie perełek albo płytek do mikromianowania, fluorku poliwinylidyny
znanego pod nazwą ImmulonR), bibuły dwuazowanej, błon nylonowych, perełek aktywowanych
i perełek Proteiny A. W formacie heterogennym można np. stosować płytki do mikromianowania
Dynatech ImmulonR 1 albo Immulon 2 albo perełki polistyrenowe o średnicy 0,25 cala
(Precision Plastic Bali). Stałe podłoże zawierające typowo swoisty epitop albo epitop swoisty
dla wiązki typów zazwyczaj przemywa się po oddzieleniu go od badanej próbki a przed detekcją
związanych przeciwciał. Formaty standardowe i kompetytywne są znane w piśmiennictwie.
W formacie homogennym, badaną próbkę inkubuje się z typowo swoistym epitopem albo
z epitopem swoistym dla wiązki typów w roztworze. Przykładowo, próbę prowadzi się w
warunkach, w których zachodzi precypitacja utworzonych kompleksów antygen-przeciwciało.
Zarówno formaty standardowe jak i kompetytywne tych prób są znane w stanie techniki.
W formacie standardowym wykonuje się bezpośredni pomiar ilości przeciwciał HCV
tworzących kompleks z epitopem typowo swoistym albo z epitopem swoistym dla wiązki typów.
Można tego dokonać przez oznaczenie zdolności wiązania znakowanych anty-ksenogenicznych
(np. anty-ludzkich) przeciwciał rozpoznających epitop na przeciwciałach anty-HCV w wyniku
powstawania kompleksu. W formacie kompetytywnym, ilość przeciwciał obecnych w próbce
oznacza się pośrednio, przez monitorowanie wpływu współzawodnictwa na wiązanie znanej
ilości znakowanego przeciwciała (lub innego kompetytywnego ligandu) w tym kompleksie.
12
175 360
W teście inhibicyjnym oznacza się zdolność przeciwciał do wiązania się z polipeptydami
zawierającymi różne epitopy typowo swoiste lub epitopy swoiste dla wiązki typów. Przeciwciała
te najpierw kontaktuje się z polipeptydami zawierającymi epitop (epitopy) dla jednego typu lub
wiązki typów HCV i następnie z polipeptydami zawierającymi epitop (epitopy) dla innego typu
lub wiązki typów HCV. Procedurę tę można powtórzyć dla dodatkowych typów lub wiązki
typów HCV.
Utworzone kompleksy zawierające przeciwciało ant-HCV (albo w przypadku próby
kompetytywnej, pewną ilość przeciwciała współzawodniczącego) wykrywa się jedną z wielu
znanych technik, zależnie od formatu. Przykładowo, nieznakowane przeciwciała HCV w kompleksie można wykryć stosując koniugat antyksenogenicznej Ig skompleksowanej ze znacznikiem (np. znacznikiem enzymatycznym).
W typowych próbach immunologicznych, badaną próbkę, na ogół próbkę biologiczną,
inkubuje się z polipeptydami zawierającymi jeden lub większą ilość epitopów typowo swoistych
albo epitopów swoistych dla wiązki typów w warunkach pozwalających na powstawanie
kompleksów antygen-przeciwciało. Można stosować różne formaty. Przykładowo, można zastosować technikę kanapkową, w której przeciwciało związane ze stałym podłożem inkubuje się
z badaną próbką, następnie podłoże przemywa się, inkubuje się z drugim znakowanym przeciwciałem przeciw badanemu typowi i powtórnie przemywa się nośnik. Badany typ wirusa wykrywa
się oznaczając, czy to drugie przeciwciało wiąże się z podłożem. W formacie kompetytywnym,
który może być heterogenny lub homogenny, badaną próbkę zazwyczaj inkubuje się z przeciwciałem oraz bądź kolejno bądź jednocześnie, ze znaczonym antygenem konkurencyjnym. Te i
inne formaty są znane w technice.
Przeciwciała skierowane przeciw epitopom typowo swoistym albo epitopom swoistym dla
wiązki typów można użyć w próbach immunologicznych do wykrywania antygenów wirusowych u pacjentów zakażonych wirusem zapalenia wątroby NANBH i u zakażonych dawców
krwi. Ponadto, przeciwciała te mogą być szczególnie użyteczne do wykrywania dawców i
pacjentów z ostrą fazą choroby.
W próbie immunologicznej można stosować np. przeciwciało monoklonalne skierowane
przeciw epitopowi typowo swoistemu albo epitopowi swoistemu wobec wiązki typów, kombinację przeciwciał monoklonalnych skierowanych przeciw epitopom jednego antygenu wirusowego, monoklonalne przeciwciała skierowane przeciw epitopom różnych antygenów
wirusowych, przeciwciała poliklonalne skierowane przeciw temu samemu antygenowi wirusowemu albo przeciwciała poliklonalne skierowane przeciw różnym antygenom wirusowym.
Procedury postępowania mogą być oparte np. na zasadzie kompetycji albo na reakcji bezpośredniej lub na technikach kanapkowych. W próbach tych można stosować podłoża stałe albo
wykorzystywać immunoprecypitację. W większości prób stosuje się znaczone przeciwciało albo
znaczony polipeptyd. Jako znaczniki stosuje się znaczniki enzymatyczne, fluorescencyjne,
chemiluminescencyjne, radioaktywne albo cząsteczki barwnika. Znane są również techniki, w
których amplifikuje się sygnały wysyłane przez sondę. Przykładami takich technik są te, w
których stosuje się biotynę i awidynę, próby immunologiczne z użyciem znaczonego enzymu i
pośrednie, takie jak ELISA.
Cząsteczkę kwasu nukleinowego według wynalazku koduje sekwencje reszt aminokwasowych opisanych powyżej epitopów typowo swoistych i epitopów swoistych dla wiązki typów.
Te cząsteczki kwasu nukleinowego są użyteczne także jako sondy, np. w próbach hybrydyzacji
Southerna albo w innych technikach identyfikacji DNA, takich jak próba wychwytywania
ujawniona w opisach patentowych Stanów Zjednoczonych Ameryki nr 4.868.105 i 5.124.246.
Badania nad mapowaniem antygenowym metodą ekspresji cDNA HCV wykazały, że
wiele klonów zawierających te cDNA wytwarzało polipeptydy reagujące immunologicznie z
surowicą pochodzącą od osobników wykazujących obecność NSNBH. Żaden pojedynczy
polipeptyd nie był reaktywny immunologicznie ze wszystkimi surowicami. Pięć z tych polipeptydów wykazywało wysoką reaktywność immunologiczną z przeciwciałami przeciw epitopom
HCV w tych polipeptydach, które to przeciwciała wykrywano w wielu różnych surowicach od
175 360
13
pacjentów, chociaż nie zachodziło całkowite nakładanie się podczas detekcji. Tak więc, wyniki
badania immunogeniczności polipeptydów kodowanych w różnych klonach świadczą o tym, że
w skutecznych systemach wykrywania zakażenia HCV można stosować panele epitopów.
Epitopy w takim panelu można konstruować w formie jednego albo wielu polipeptydów. Testy
na obecność różnych epitopów mogą być sekwencyjne albo jednoczesne.
Cząsteczki kwasu nukleinowego komplementarne do sekwencji kwasu nukleinowego
fl a nkują regiony kodujące epitopy typowo swoiste i epitopy swoiste dla wiązki typów. Takie
cząsteczki kwasu nukleinowego są potrzebne do prowadzenia enzymatycznej reakcji amplifikacji, PCR, w której oznacza się genotyp konkretnego HCV.
Należy zwrócić uwagę na obecność regionów zmiennych i hiperzmiennych w genomie
HCV. Zakłada się, że homologia w tych regionach będzie znacznie mniejsza od homologii w
całym genomie.
Techniki oznaczania homologii sekwencji kwasu nukleinowego i aminokwasowych są
znane w stanie techniki. Przykładowo, można bezpośrednio oznaczyć sekwencję aminokwasową
i porównać ją z sekwencjami według wynalazku. Alternatywnie, można oznaczyć (zwykle
poprzez pośredni cDNA) sekwencję nukleotydową materiału genomowego przypuszczalnego
typu wirusa HCV, następnie oznaczyć kodowaną przez nią sekwencję aminokwasową i porównać odpowiednie regiony.
Przykład I
Porównanie głównych epitopów wielu różnych typów HCV
Porównano homologię reszt aminokwasowych występującą między różnymi typami i
podtypami HCV dla różnych regionów. Podtyp HCV jest taki, jak opisany metodą analizy
filogenetycznej Simmonds’a. Numery sekwencji aminokwasowej odpowiadają numerom opisanym dla prototypowej sekwencji HCV-1 (Choo i wsp.). Tabela 2 przedstawia homologię reszt
aminokwasowych wyrażoną w procentach dla epitopów typowo swoistych i epitopów swoistych
dla wiązki typów regionu NS4 i dla konserwatywnego głównego epitopu. Tabela 3 przedstawia
homologię reszt aminokwasowych pomiędzy dwoma epitopami typowo swoistymi albo epitopami swoistymi dla wiązki typów regionu NS5. Tabela 4 przedstawia homologię reszt aminokwasowych wyrażoną w procentach dla konserwatywnych głównych epitopów i epitopów
typowo swoistych z regionu rdzeniowego.
T a b e la 2
Homologie aminokwasowe (w%) między różnymi podtypami HCV
Podtyp
HCV
Przykłady
skrótów typów
Główne
epitopy
typowo
swoiste
regionu NS4
(1689-1718 aa)*
Główny
epitop
konserwatywny
regionu NS4
(1910-1936 aa)*
la
HCV-1
(1a)/(1a)
100 %
100 %
1b
HCV-J
(1a)/ (1b)
83 %
100 %
2a
HCV-J6
(1a)/ (2a)
47 %
93 %
2b
HCV-J8
(1a)/ (2b)
43 %
93 %
14
175 360
T a b e la 3
Homologie aminokwasowe (w%) między różnymi podtypami HCV
Podtyp
HCV
Przykłady
typów
skrótów
Główne
typowo
epitopy
swoiste
regionu NS5
(2281-2313 aa)*
Główny
epitop
konserwatywny
regionu NS4
(2673-2707 aa)*
la
HCV-1
(1a)/ (1a)
100 %
100 %
1b
HCV-J
(1a)/ (1b)
76 %
89 %
2a
HCV-J6
(1a)/ (2a)
70 %
83 %
2b
HCV-J8
(1a)/ (2b)
73 %
83 %
3a
HCV-E-bl
(1a)/ (3a)
77
3b
HCV-Tb
(1a)/(3b)
83 %
T a b e la 4
Homologię reszt aminokwasowych (w%) między różnymi podtypami HCV
Podtyp
HCV
Przykłady
typów
skrótów
Konserwatywne
główne
epitopy
regionu
rdzeniowego
(10-45 aa)*
Główne
epitopy
typowo-swoiste
regionu
rdzeniowego
(67-84 aa)*
la
HCV-1
(1a)/ (1a)
100 %
100 %
1b
HCV-J
(1a)/(1b)
98 %
100 %
2a
HCV-J6
(1a)/ (2a)
98 %
61 %
2b
HCV-J8
(1a)/ (2b)
98 %
61 %
3a
HCV-E-b1 (1a)/ (3a)
93 %
89 %
4
HCV-EG-21
98 %
83 %
(1a) / (4)
Przykład II
Synteza peptydów
Zsyntetyzowano dwa zestawy polipeptydów. Pierwszy zestaw zaprojektowano w celu
przeprowadzenia mapowania epitopów HCV-1 a drugi zestaw zaprojektowano tak, aby mógł
służyć do oznaczeń, które epitopy zidentyfikowane w badaniach nad mapowaniem epitopów są
epitopami typowo swoistymi. W pierwszym zestawie polipeptydów zsyntetyzowano techniką
"Mimotopes" 64 zestawy (oraz duplikaty) częściowo nakładających się oktapeptydów obejmujące całą poliproteinę HCY-1 (3011 reszt aminokwasowych).
175 360
15
Drugi zestaw polipeptydów przygotowano sposobem opisanym przez Geysen’a (J. Trop.
Med. Pub. Health, 21,523 - 533,1990) i Merrifield’a (J. Am. Chem. Soc. 85,2149 - 2154,1963).
W tym drugim zestawie polipeptydów, do syntezy epitopu typowo swoistego wyselekcjonowano cztery regiony antygenowe reprezentujące główne epitopy niekonserwatywnych sekwencji w HCV-1 z rdzenia, z regionów NS4, NS5 i odpowiednich sekwencji z podtypów
HCV-1b, 2a, 3a i 4. Sekwencję z rdzenia wyselekcjonowano z mniej konserwatywnego regionu
reszt aminokwasowych 67 - 88. Sekwencję z regionu NS4 wyselekcjonowano z reszt aminokwasowych 1689-1718. Sekwencje z regionu NS5 wyselekcjonowano z reszt aminokwasowych
2281-2313 i 2673-2707.
Przykład III
Próbki biologiczne
W celu oznaczenia efektywności polipeptydów pod względem rozróżniania poszczególnych przeciwciał swoistych wobec różnych typów HCV, zebrano surowice od 24 zakażonych
chronicznie wirusem NANBH z różnych obszarów świata, w tym ze wschodniego i zachodniego
wybrzeża Stanów Zjednoczonych, z Japonii, krajów Europy Zachodniej, krajów Europy Południowej i Południowej Afryki. Izolację wirusowego RNA, syntezę cDNA, reakcje amplifikacji
PCR, sekwencjonowanie DNA i hybrydyzację z sondami oligonukleotydowymi prowadzono w
sposób opisany przez Cha i wsp., Proc. Natl. Acad. Sci. USA, 89, 7144 - 7148, 1992.
Przykład IV
Procedury mapowania epitopu
W celu określenia, które regiony HCV zawierają epitopy bądź grupowo dwoiste bądź
konserwatywne, poddano mapowaniu całą poliproteinę HCV-1. Zastosowany sposób w zasadzie
odpowiada schematowi przedstawionemu na fig. 2.
Zsyntetyzowano techniką "Mimotopes" 64 zestawy (oraz duplikaty) częściowo pokrywających się oktapeptydów w oparciu o całą poliproteinę HCV-1 (3011 aminokwasów). Do
mapowania epitopów i analizy epitopów swoistych dla wiązki typów wyselekcjonowano panel
40 próbek, z których 25 było próbkami reaktywnego przeciwciała HCV ze Stanów Zjednoczonych, 9 próbek zawierających reaktywny HCV pochodziło z Japonii a 6 próbek, były to próbki
nie zawierające HCV, stanowiące kontrolę negatywną. Próby immunologiczne wykonywano
standardową techniką ELISA.
Kryteria identyfikacji głównych epitopów oparto na częstości reakcji przeciwciała i
intensywności reakcji przeciwciała (miano) przeciw tym epitopom. Wyniki są przedstawione na
fig. 3 i 4.
Przykład V
Enzymatyczna próba immunologiczna peptydo-pochodna (peptydo-pochodna technika ELISA).
W celu ustalenia optymalnej próby immunologicznej, w której byłyby użyte polipeptydy
opisane w przykładzie II, przeprowadzono dwa oddzielne typy peptydo-pochodnej próby ELISA
i porównano wyniki. Pierwszym typem próby ELISA był "Nunc MaxiSorb™" polegający na
prostej adsorpcji peptydów. W drugim typie użyto zestaw "Nunc Covalinc NH™". W tym teście
polipeptydy były wiązane kowalencyjnie. Tworzenie wiązań amidowych między kwasami
karboksylowymi a aminami inicjowano przez dodanie karbodiimidu. W celu zmniejszenia
hydrolizy, można wytworzyć aktywny ester, dodając do powyższej mieszaniny koniugacyjnej
N-hydroksy-sulcynimidu (NHS).
W pierwszym typie próby ELISA przygotowywano płytki do mikromianowania następująco: Polipeptydy umieszczano w dołkach płytek do mikromianowania Nunc MaxiSorbT w
stężeniu 1 μg/dołek w 100 μl soli fizjologicznej buforowanej fosforanem (PBS). Polipeptydy
pozostawiono do absorpcji przez dobę w temperaturze pokojowej. Następnie płytki przemywano
cztery razy roztworem PBS bez detergenta, po czym dołki pokrywano ilością 220 μl odczynnika
SuperblockR (Pierce) przez godzinę, następnie zasysano bez dalszego przemywania i suszono
pod zmniejszonym ciśnieniem.
16
175 360
Oznaczenie prowadzono w sposób następujący: próbkę surowicy o objętości 5 μl nanoszono do dołków z dodatkiem 100 μl 5% odtłuszczonego mleka i inkubowano przez godzinę w
temperaturze 37°C. Następnie dołki przemywano 5 razy w roztworze PBS z dodatkiem 0,05%
Tween’u. W celu oznaczenia stopnia wiązania ludzkich przeciwciał do polipeptydów zastosowano koniugat charakteryzujący się powinowactwem oczyszczonej IgG koziej anty-ludzkiej
znakowanej peroksydazą chrzanu (Jackson Laboratories). Koniugat ten uprzednio rozcieńczano
do stężenia IgG wynoszącego 5% w 150 mM NaCl, PBS, 5% surowicy końskiej (denaturowanej
ciepłem). Ilości po 100 μl tego koniugatu umieszczano w dołkach i inkubowano przez godzinę
w temperaturze 37°C. Następnie dołki przemywano 5 razy roztworem PBS/Tween z dodatkiem
OPD [dwuchlorowodorku orto-fenyleno-diaminy w ilości jedną tabletkę na bufor wywołujący
(0,02% roztwór H 2 O2 buforowany buforem cytrynianowo-fosforanowym, Sigma] przez 30 minut w temperaturze pokojowej, po czym oznaczano przeciwciała przy 492 nm i 620 nm. Odcięcie
oznaczano na podstawie 200 losowych (normalnych) próbek, gdzie 7 odchyleń standardowych
od średniej wynosiło około 0,45.
Płytki do mikromianowania dla drugiego typu oznaczeń techniką ELISA przygotowano
następująco. Polipeptydy umieszczano w dołkach płytek do mikromianowania "MaxiSorb" w
stężeniu 10 mg/dołek w 50 μl wody. Do tych polipeptydów dodano 25 μl 0,1 M odczynnika
NHS (sulfo-N-hydroksy-sukcynimid, Pierce) i 25 μl 0,1 M EDC [1-etylo-3-(3-dimetyloaminopropylokarbodiimid, Sigma] i mieszano w temperaturze pokojowej w czasie 30 minut na tacy
wahliwej. Następnie, całą zawartość dodano do 52 ml schłodzonego lodem 0,1 M roztworu
węglanu sodowego o wartości pH = 8,6. Ilość 100 μl tej mieszaniny stosowano do pokrywania
dołków w płytkach do mikromianowania i następnie inkubowano w temperaturze 4°C w czasie
30 minut. Płytki przemywano 4 razy roztworem o składzie: PBS/0,1%, Triton X-100. Płytki te
traktowano odczynnikiem o nazwie "Superblock" i dalej prowadzono próbę w sposób podany
powyżej.
Uzyskane wyniki są przedstawione w tabelach 5 -14.
Przykład VI
Test inhibicyjny
Testy inhibicyjne przeprowadzono w celu stwierdzenia, czy badane peptydy mogą między
sobą współzawodniczyć o wiązanie z przeciwciałami. Zsyntetyzowano trzy zestawy krótkich
polipeptydów z regionów rdzeniowych NS4 i NS5 różnych typów sekwencji HCV. Polipeptydy
te pokrywają regiony sekwencji aminokwasowych od 1689 do 1696, od 1696 do 1702 i od 1711
do 1917. Testy inhibicji prowadzono dodając do próbki 10 μg powyższych polipeptydów i
inkubując próbki w temperaturze 37°C w czasie godziny, po czym prowadzono oznaczenie
techniką ELISA, jak opisano powyżej. W przypadkach, kiedy hamowanie wiązania przeciwciała wynosiło powyżej 50%, uznawano, że polipeptyd ma działanie hamujące.
Wyniki są przedstawione w tabeli 15.
Przykład VII
Klasyfikowanie HCV w próbce klinicznej
Epitopy typowo swoiste lub swoiste dla wiązki typów przedstawione w tabeli 16, powyżej,
użyto w próbie ELISA opisanej w przykładzie V do badania 13 próbek klinicznych pochodzących od pacjentów z zapaleniem wątroby nie-A, nie-B (10 płatnych dawców, 3 pacjentów z
nabytym przez transfuzję zapaleniem wątroby nie-A, nie-B). W tabeli 17 przedstawione są
wyniki tych prób. W każdej próbce klinicznej oznaczano reaktywność z dwunastoma różnymi
peptydami odpowiadającymi podanym regionom (aa 67 - 84, 1689 - 1718 lub 2281 - 2313)
reprezentującym różne epitopy typowo swoiste lub swoiste względem wiązki typów. Każda
próbka daje z danym charakterystycznym dla typu peptydem następującą odpowiedź: brak
reakcji (NR), słaba reakcja (WR) albo reakcja (R). Wyniki tej próby określają genotyp HCV dla
każdej próbki, korelujący z genotypem HCV oznaczonym w łańcuchowej reakcji z udziałem
polimerazy, PCR, podanym w kolumnie po prawej stronie.
Próbki
dawców
Reakcja
Reakcja
z pospolitymi
próbki
z pospolitymi
84-018669
(II)
Reakcja
6.57
epitopami
6.45
3.76
7.88
6.20
8.94
z epitopami
epitopami
dawców
4.23
6.48
6.84
3.41
Peptyd
(typ HCV)
w różnych
HCV
od
typu
NDRVVVAPDKEILYEAFDEMEECASKAALI
d la
typów
Sod100
(1 a)
i 2b
(1a)
1 a , 1 b , 2a
ELISA
cp402-10(1a)
cp402-11 1b)
cp402-12(2 a)
cp402-13(2b)
i 2b.
ELISA
typowo-swoistymi
1 a , 1b , 2a
sodC100
cp402-10(1a)
cp402-11 1b)
cp402-12 2a
cp402 -13 (2,b)
PDREVLY
K I
PDREVLY
K I
NQRAWAPDKEVLYEAFDEMEECASRAALI
cp402 -13 (2b)
cp402-12 (2a)
SGRPAVIPDREVLYQFDEMEECASHLPYI
SGKPAIIPDREVLYREFDEMEECSQHLPYI
zależne
SGKPAIIPDREVLYREFDEMEECSQHLPYI
Sekwencje
typach
cp4 02 - 1 1 (1b)
cp402-10(1a)
epitopów
NS4(1689-1718)
Peptyd
EIA
serotypowa
płatnych
sekwencji:
ID
Analiza
Próbki płatnych
LL57406
(I)
Region
Próbka
Tabel a 5 .
175 360
17
Próbki
dawców
Reakcja
epitopami
7.25
5.74
7.43
8.89
14.5
epitopami
z epitopami
z pospolitymi
próbki
z pospolitymi
Reakcja
FF25931
(II)
Reakcja
6.87
dawców
5.54
9.71
8.28
6.63
Peptyd
z różnych
typów HCV
w różnych
od
typu
NDRVVVAPDKEILYEAFDEMEECASKAALI
d la
typów
sod100
*
(1a)
(1a)
1a , 1 b , 2a
ELISA
cp402-10(1a)
cp402-11(1 b )
cp402-12(2a)
cp402-13(2b)
i 2b.
ELISA
typowo-swoistymi
1 a , 1 b, 2a
sodC100
cp402-10(1a )
cp402-11(1b)
cp402-12(2a)
cp402-13(2b)
*
i 2b
PDREVLY
K I
PDREVLY
K I
*
*
NQRAWAPDKEVLYEAFDEMEECASRAALI
cp402- 13 (2b)
cp402 -12 (2 a)
SGRPAVIPDREVLYQFDEMEECASHLPYI
SGKPAIIPDREVLYREFDEMEECSQHLPYI
zależne
SGKPAIIPDREVLYREFDEMEECSQHLPYI
___
HCV
Sekwencje
typach
cp402- 1 1 (1 b)
cp402-10(1a)
epitopów
NS4 (1689-1718)
Peptyd EIA
syqnał/odcięcie
serotypowa
płatnych
Próbki płatnych
FF25910 (1a)
(I)
Region sekwencji:
Opis próbki
Tabela6. Analiza
18
175 360
Próbki
dawców
MT-79
(2a, 2b)
MT-32
(2a i 2b)
(I)
Peptydy
z różnych
typów HCV
w różnych
HCV
zależne
od
typu
(1A)
sod100
0.41
ELISA
cp402-10(1a)
cp402-11 1b )
cp402-12(2a) reaktywne
cp402-13(2b)
(1a)
0.27
0.34
5.53
4.72
ELISA
sod C 100
0.23
*
cp402- 1 0 (1a)
cp402-11 1b
cp402-12(2a) Reaktywne
cp402-13(2b)
*
*
swoistym epitopem
swoistym epitopem
CASRAALI
CASKAAL
z typowo
CASRAAL
CASKAAL
z typowo
*
NDRVVVAPDKEILYEAFDEMEECASKAALI
0.68
0.67
7.81
6.88
cp402 -13 (2b)
NQRAWAPDKEVLYEAFDEMEECASRAALI
cp402 -12 (2a)
SGRPAVIPDREVLYQEFDEMEECASHLPYI
SGKPAIIPDREVLYREFDEMEECSQHLPYI
SGKPAIIPDREVLYREFDEMEECSQHLPYI
Sekwencje
typach
cp402-10(1a)
cp402-1 1 (1b)
epitopów
NS4 (1689-1718)
Peptyd EIA
sygnał/odcięcie
serotypowa
płatnych
Region sekwencji:
oPIS PRÓBKI
Tabela7 . Analiza
175 360
19
8, Analiza
FF25951
(1a)
r-NS5
0.43
1.47
2.03
1.28
1.65
2,28
krytycznej
w tej
od
typu
próbce
C
C
AQ
AQ
P
*
P
*
ISSLTERLYCGGPMFNSKGQTCGYRRCRASGVLPT
IHSLTERLYVGGPMTNSKGQTCGYRRCRASGVFTT
ISSLTERLYVGGPMFNS KGQSCGYRRCRASGVLTT
IHSLTERLYVGGPMFNSKGQTCGYRRCRASGVLTT
IRSLTERLYIGGPLTNSKGQNCGYRRCRASGVLTT
zależne
IKSLTERLYVGGPLTNSRGENCGYRRCRASGVLTT
dawców
r-NS5
ELISA
(1a)
zmieniona w odpowiedzi
cp402- 8 (3a)
cp402-7(2b)
cp402-9(3b)
cp402-6(2a)
cp402-5(1b)
cp402-4(1a)
w epitopie
ELISA
cp402-8 (3a)
4.40
0.58
cp402-7 (2b)
cp402-9 (3b)
3.38
3.56
cp402-6(2a)
cp402-5(1b)
HCV
Sekwencje
typach
płatnych
4.62
4.75
od
cp402-4(1a)
NANBH
Peptydy
z różnych
typów HCV
w różnych
3.39
S/CO
wątroby
epitopów
(2673-2707)
4.31
Zmiana sekwencji krytycznej
epitopu w tej próbce
(2)
sekwencji
84-018433
(2B)
Zmiana
(1)
EIA
NS5
serotypowa
zapalenie
Peptyd
(I) Chroniczne
Region sekwencji:
opis próbki
Tabela
20
175 360
. Analiza
96727
od
cp402-9 (3b)
cp4 02-7 (2b)
r-NS5
0 .58
1.68
w tej
cp402-9 (3b)
cp402-7 (2b)
0.79
0.60
od
typu
próbce
C
C
AQ
AO
FP
*
FP
ISSLTERLYCGGPMFNSKGAQCGYRRCRASGVLPT
IHSLTERLYVGGPMFNSKGQSCGYRRCRASGVFTT
ISSLTERLYVGGPMFNSKGQSCGYRRCRASGVLTT
IHS LTERLYVGGPMFNSKGQTCGYRRCRASGVLTT
IRSLTERLYIGGPLTNSKGQNCGYRRCRASGVLTT
zależne
IKSLTERLYVGGPLTNSRGENCGYRRCRASGVLTT
dawców
r-NS5
ELISA
(1a)
zmieniona w odpowiedzi
cp402-8 (3a)
cp402-6(2 a )
3 .41
2.52
cp402-5(1b)
cp402-4(1a)
w epitopie
ELISA
cp402-8(3a)
3.15
3.80
krytycznej
0.48
cp402-6(2a)
1.16
1.52
cp402-5(1b )
HCV
Sekwencje
typach
płatnych
cp402-4(1a )
NANBH
Peptydy
z różnych
typów HCV
w różnych
1.01
1.07
S/CO
wątroby
epitopów
(2673-2707)
5.54
Zmiana sekwencji krytycznej
epitopu w tej próbce
(2)
sekwencji
84-018366
EIA
NS5
serotypowa
zapalenie
Peptyd
Chroniczne
Zmiana
(1)
(I)
Region sekwencji:
opis próbki
Tabela 9
175 360
21
(HCV-1)
CASRAAL
K QS
K
P
A
KGQSCGYRRCRASGVFTT
*
KGAQCGYRRCRASGVLPT
*
Epitopy typowo swoiste
(2281-2313]
HCV-1a i 1b P D Y E P P W H G
V
H C V -a
2
PDYQPATVAG
H C V -2b
PSYEPPTVLG
HCV-1a
FAQALPVW
HCV-1b ,2a i 2b FPPOALPIW
i 2b
CASHLPY
HCV-2a
HCV-1b
CSQHLPY
swoiste
swoiste
HCV-1A
Epitopy typowo
(1689-17181
Egitopy typowo
KI
PDREVLY
(1 a , 1b))
(1 a , 1 b , 2a,
2b,
- HCV-2b
(2a,
2b)
Epitopy konserwatywne
(1689-1718)
F(4)
PGYPWP
Epitopy konserwatywne
- HCV-3a
epitopów
HCV-1a i 1b-PEGRTWAQ
HCV-2a i 2b -STGKSWGK
HCV-3a lub4-gEGRSWAQ
Epitopy konserwatywne
(2673-2707)
RGENCGYRRCRASGVLTT
- HCV-1a
K QT
HCV-1 b ,2a
HCV-3b
konserwatywne
Region NS5
Epitopy konserwatywne
(2288-2294)
WARPDYN
RGNHVSPTHYV
Region NS4
Główne epitopy
(1925-1935)
TNRRPQDVKFPGGGQIVGGVY
LLPRRGPRLG
(HCV-1)
Region rdzeniowy:
Główne epitopy konserwatywne
Tabela 10 . Zestawienie głównych typowo swoistych
w części rdzeniowej i w regionach NS4 i NS5
3a)
22
175 360
( 2b) 4.75
96696 1.02
(2b) 7.52
8 4 - 0 1 0 4 3 3 0.31
r C 2 2 ELISA
6.23
(2-120
cp401-04(3a)
cp4 0 1 - 0 5 ( 4 )
1.04
1.37
c p 4 0 1 - 0 2 ( 2a&2b)
c p 4 0 1 - 0 1 ( 1 a &1 b )
(2-120
cC22
6.10
ELISA
cp401-04(3a)
c p 4 0 1 - 0 5 (4)
c p 4 0 1-02(2a&2b)
Cp 4 0 1 - 0 1 ( 1a&1b)
c p 4 0 1 - 0 1 ( 1 a & 1b )
c p 4 0 1 - 0 2 ( 2 a &2b)
c P 4 0 1 - 0 4 ( 3a)
c p 4 0 1 - 0 5 (4)
rC22 E LI SA( 2- 120
c p 4 0 1 - 0 1 ( 1 a &1 b )
cp401-02(2A&2b)
c p 4 0 1 - 0 4 ( 3a)
c p 4 0 1 - 0 5 (4)
Peptyd (typ HCV)
1.08
0.99
7.56
7.79
6.86
6.61
Peptyd EIA S/CO
aa)
STGKSWGK
PEGRTWAQ
aa)
F
PGYPWP
*
**
**
SEGRSWAQ
SEGRSWAQ
*
SECRSWAQ
SEGRSWAQ
Epitopy typowo swoiste
PEGRTWAQ
konserwatywny
stgkswgk
aa)
E p itop
KARRPEGRTWAQPGYPWP
KDRRSTGKSWGKPGYPWP
KARR
SEGRSWAQ PGYPWP
KARR
SEGRSWAQ PGFPWP
Sekwencje typowo zależne
Analiza serotypowa epitopów z różnych typów sekwencji HCV (I) z próbek chronicznego zapalenia wątroby NANBH od płatnych
dawców.
Region sekwencji: rdzeń (67-84)
8 4 - 0 1 7 7 8 6 7.93
( 1a)
Próbka ID
Tabela 11 .
175 360
23
96690 (1a)
84-01778(2a)
(1)
(2)
cp402-00(1a)
cp4 02-01(1b)
cp402-02 (2a)
cp4 02-03 (2b)
r-NS5ELISA(1a)
0.42
r-NS5ELISA(1a)
5.64
2.41
0.47
5.99
0.42
cp4 02-01(1b)
cp4 02-02 (2a)
cp4 02-03 (2b)
cp402-00(1a)
1.57
1.16
0.17
4.59
PP
PP
PP
PDYQPATVAG
epitop zależny od typu
epitop zależny od typu
I
A
P
FAQALPVW
F A Q A L P V VVARPDYNPPLVETWKKPDYEPPWHG
F P P A L P I VVARPDYNPPLLESWKDPDYVPPWHG
FPPALP AWARPDYNPPLVESWKRPDYQPATVAG
FPPALP PWARPDYNPVLIETWKRPGYEPPTVLC
Sekwencje zależne od typu
Analiza serotypowa epitopów z różnych typów sekwencji HCV (I) z próbek chronicznego zapalenia wątroby NANBH
od płatnych dawców.
Region sekwencji: NS5 (2281-2313)
Próbka ID. Peptyd E1A S/CO
(typ I-ICV)
Tabela 12.
24
175 360
NAC5 (1b)
cp402-00(1a)
cp402-01(1b)
cp4 02-02 (2a)
cp4 02-03 (2b)
r-NS5ELISA
6.36
6.44
4.38
5.52
5.30
cp402-00(1a)
cp4 02 -01 (1b)
cp402-02(2a
cp402-03(2b)
7.28
6.59
0.10
0.4 7
Epitopy typowo nieswoiste (konserwatywne)
(2) FF2 5912 (1a)
(1)
(typ HCV)
WARPDYN
WARPDYN
WARPDYN
WARPDYN
WARPDYN
FAQALPV
FPPALPI
FPPALPA
FPPALPP
PDYEPPWHG
PDYVPPWHG
PDYQPATVAG
PGYEPPTVLG
PDYQPATVAG(2 a)
PGYEPPTVLG(2b)
PDYEPPWHG (1a)
PDYVPPWHG (1b)
PPLVETWKK
PPLLESWKD
PPLLESWKR
PVLIETWKR
Sekwencje zależne od typu
Analiza serotypowa epitopów z różnych typów sekwencji HCV (I) z próbek chronicznego zapalenia wątroby NANBH
odpłatnych dawców.
Region sekwencji: NS5 (2281-2313)
Próbka ID, peptyd ELA. S/CO
Tabela 13.
175 360
25
W1 (1a)
MT56 (1a
(2)
(3)
r-NS5
6.89
ELISA
Cp402-00(1a)
cp402-01 (1b)
cp4 02-02 (2a)
cp402-03 (2b)
7.39
5.07
0.36
7 .00 cP4 02-00 (1a)
5.43
cp402-01 (1b)
0.56
cp4 02-02 (2a)
0.58
cp402-03 (2b)
6.86
r-NS5ELISA(1a)
*
P
V I
Typowo swoisty epitop (1a i 1b)
Typowo swoisty epitop
Typowo swoisty epitop ( 1a i 1b)
r-NS5ELISA
6.36
FAQALPVW ARPDYNPPLVETWKK
FPPALPIWARPDYNPPLLESWKD
FPPALPAWARPDYNPPLVESWKR
FPPALPPWARPDYNPVLIETWKR
cp402- O O (1a)
cp4 02-01(1b)
cp40 2 -0 2(2a)
cp40 2-0 3 (2B)
7.28
6.59
0.10
0.47
St 1b) 7.68
MAC5(1b)
(1)
(typ HCV)
Sekwencje zależne od typu
*
*
*
PDYQPATVAG
PDYEPPWHG (1a)
PDYVPPWHG (1b)
*
PDYEPPWHG (1 a )
PDYVPPWHG (1b)
PDYQPATVAG(2a)
PGYEPPTVLG(2b)
PDYEPPVVHG
PDYVPPWHG
PDYQPATVAG
PGYEPPTVLG
14. Analiza serotypowa epitopów z różnych typów sekwencji HCV (I) z próbek chronicznego zapalenia wątroby NANBH
od płatnych dawców.
Region sekwencji: NS5 (2281-2313)
Próbka ID peptyd E1A S/CO
Tabela
26
175 360
2.
3.
4.
5.
6.
7.
8.
9.
10.
1.
Tabela 15
SQHLPY
ASRAAL
ASKAAL
PDREVLY
PDYRPPWHG
PDYQPATVAG
FAQALPVW
FPPQALPPW
STGKSWGK
SEGRSWAQ
CHI EN- 101
CHI EN- 102
CHI EN- 103
CHI EN- 104
CHI EN- 105
CHI EN- 10 6
CHI EN- 107
CHI EN- 108
CHI EN- 109
CHI EN- 11 0
Rdzeń
Rdzeń
Region NS5
Region NS4
1712-1717
1712-1717
1712-1717
1696-1972
2304-2313
2304-2313
2281-2288
2281-2288
71-78
71-78
la
2a
2b
1 a , 1b , 2a
1a
2a
1a
2b
2a & 2b
4
175 360
27
H CV -1 b , 2 a
HCV-3b
K
K
QT
QS
HCV- 1a
(2673-2707)
RGENCGYRRCRASGVLTT
WARPDYN
Region NS5: (2288-2294)
( HCV-1)
NS4: (1925-1935)
RGNHVSPTHYV
Region
TNRRPQDVKFPGGGQIVGGVY
LLPRRGPRLG
(HCV-1)
Region rdzeniowy: (15-45)
& 2b
FPPQALPIW
H C V - 1 b ,2a&2b
P T - - HCV-3a
*
KGQSCGYRRCRASGVFTT-HCV- 2 b
KGAQCGYRRCRASGVL
FAQALPVW
HCV-1a
A
P
PDYQPATVAG
PGYEPPTVLG
V
PDYEPPWHG
CSQHLPY
CASHLPY
CASRAAL
K
PEGRTWAQ
STGKSWGK
SEGRSWAQ
HCV-2a
HCV-2b
HCV-1a & 1b
(228 1 -2 3 1 3 )
HCV-1a
HCV-1b
HCV-2a
(1689-1718)
HCV-1a & 1b
HCV-2a & 2b
HCV-3a or 4
(67-84)
Epitopy typowo
swoiste
Główne typowo swoiste epitopy HCV w rdzeniu i w regionach NS4 i NS5
Główne epitopy
konserwatywne
Tabela 16.
( 1 a , 1 b , 2 a , 2 b , 3a)
PDREVLY
K I
(1 a , 1b)
(2a,2b)
(1689-1718)
F (4)
PGYPWP
(67-84)
Epitopy konserwatywne
28
175 360
Serotyp .XLS
96996
84-017786
83-018433
NR
NR
L2
NR
WR
R=OD SYGNAŁ > 1,5 OD
WR = 1.0 OD <SYGNAŁ < 1,5 OD
NR
NR
NR
NR
NR
ODCIĘCIE
OD=1.0
R
NR
NR
NR
NR
NR
NR
NR
NR
N
R
NR
NR
NR
NR
NR
NR
R
N
NR
NR
NR
NR
NR
NR
R
N
NR
NR
R
NAC5
R
NR
R
CHRONICZNE
N A NBH PO
TRANSFUZJI
NR
NR
NR
84 017778
NR
NR
NR
NR
NR
NR
NR
NR
NR
3a
1a
FF 25912
NR
NR
R
NR
NR
NR
NR
2b
NR
NR
NR
WR
NR
1b
NR
WR
NR
NR
R
NR
R
NR
R
R
N
R
WR
NR
NR
NR
R
R
R
N
25931
WR
R
R
R
2a
NR
NR
NR
NR
NR
R
1a
NR
NR
NR
NR
R
WR
NR
WR
WR
R
WR
NR
NR
NR
NR
NR
R
NR
NR
NR
NR
NR
N
R
R
NR
NR
R
NR
NR
NR
NR
NR
NR
NR
NR
NR
1b
R
NR
NR
2a
R
NR
2b
NR
1a
NR
2b
NR
1a
NR
1b
NR
1a
NR
N
R
R
84 18 699
R
FF 25910
1a
NR
2a
NR
GENOTYP
1a
NR
NR
NR
NS5 (2281 2313)
1a
NR
NR
3a
2a i 2b
NS4(1689-1718
a1
96727
1a i 1b
rdzeń ( 6 7 84aa)
2b
FF 25951
PRÓBKI
NANBHOD
PŁATNYCH
DAWCÓW
OPIS
PRÓBKA
PRÓBKA KLINICZNA HCV OCENIANA WEDŁUG GENOTYPÓW
Tabela 17.
175 360
29
NR
R
R N
175 360
FIG. 1
175 360
175 360
FIG. 2
FIG. 3
175 360
FIG. 4
175 360
Departament Wydawnictw UP RP. Nakład 90 egz.
Cena 6,00 zł
Документ
Категория
Без категории
Просмотров
2
Размер файла
1 695 Кб
Теги
pl175360b1
1/--страниц
Пожаловаться на содержимое документа